DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actl9

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_899105.2 Gene:Actl9 / 69481 MGIID:1916731 Length:415 Species:Mus musculus


Alignment Length:369 Identity:147/369 - (39%)
Similarity:219/369 - (59%) Gaps:8/369 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYPI 112
            |||||.|:|.||.||:.:..|.....:|:|.........|....::.||| |||.|..|.|..||
Mouse    50 AVVIDMGTGTCKVGFAGQSQPTYTVATILGCQPKKQATKDQSELETFIGE-AARSRPELRLVKPI 113

  Fly   113 EHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFYVAV 176
            .:|:|.:|:..|::|:|..|. |:....:.|.|.::.|.:|..||||:.|:.||....||.|||.
Mouse   114 RNGIVVDWEAAELIWRHILEHDLQVATHEHPLLFSDPPFSPATNREKLVEVAFESLHSPALYVAS 178

  Fly   177 QAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMG 241
            |:|||:||.||..|:|||:|.||::|||:.:|:.||||..|:||||..||.:|.::||..|.:: 
Mouse   179 QSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRLDLAGNHLTAFLAEMLLGSGFSL- 242

  Fly   242 TSAEREIVREIKEKLCYVSMNYAKEM---DLHGKVETYELPDGQKIVLGCERFRCPEALFQ-PSL 302
            ...:.::|..||...||::.::.||.   |...| ::.:||||:.:.||.|.|:|||.||. |.:
Mouse   243 QQEDLDLVENIKHHYCYLAPDFQKEQARPDEECK-QSLKLPDGRTVTLGKELFQCPELLFHPPEI 306

  Fly   303 LGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNA 367
            .|...:|:......|:.....:||..:..|::|.||:::|..:|.||..:|.....|...:.|.|
Mouse   307 PGLSPIGLPAMAEQSLLKVPQELRPHVARNVILCGGSSLFTGLEGRFRAELLHSLSPEDHVVVMA 371

  Fly   368 SPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            .|:|..|||.|||:||||.:||:.|:...:|||.|..:|:|||:
Mouse   372 HPNRNLSVWIGGSILASLHAFQSCWVLREQYEERGPQVVYRKCY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 146/367 (40%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 146/367 (40%)
Actl9NP_899105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ACTIN 48..414 CDD:214592 145/366 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.