DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actr6

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_080190.1 Gene:Actr6 / 67019 MGIID:1914269 Length:396 Species:Mus musculus


Alignment Length:411 Identity:113/411 - (27%)
Similarity:187/411 - (45%) Gaps:71/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VVIDNGSGVCKAGFSPEDT---PRAVFPSIVGRPRHLNV-LLDSVIGDSVIGEAAARKRGILTLK 109
            :|:|||:...|.|:|.:..   |...|.|...|.:.... .:|.:...|          |:..: 
Mouse     4 LVLDNGAYNAKIGYSHDSVSVIPNCQFRSKTARLKTFTANQIDEIKDPS----------GLFYI- 57

  Fly   110 YPIEHGMVKNWDEMEMVWQHTY--ELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAF 172
            .|.:.|.:.|||....||.:.:  |:.:.|.:|...::||...|....:|.|.||:||.:|    
Mouse    58 LPFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQ---- 118

  Fly   173 YVAVQAVLSLYATGRTVG------------IVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDL 225
               .||||.:.|...:..            |:||||...||.||.........|.:|:::.|:.|
Mouse   119 ---FQAVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLL 180

  Fly   226 TDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMD---LHGKVET----YELPD--- 280
            |::|.:::..|  .:....|..::.::||.:||||.::.::||   |.|:..|    |.|||   
Mouse   181 TNHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEDNTVMIDYVLPDFST 243

  Fly   281 --------------------GQKIV-LGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMD 324
                                |::|: |..|||..||.||.||.:|.:.|||.||..:||.|...:
Mouse   244 IKKGFCKPREEMVLSGKYKFGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEE 308

  Fly   325 LRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDRRFSV-WTGGSVLASLTSF 388
            ::...:.||||:||.::|.....|...::..:.|....:.| ..|:...:. |.||.:::....|
Mouse   309 MQPHFFKNIVLTGGNSLFPGFRERVYSEVRCLTPTDYDVSV-VLPENPITYSWEGGKLISENDDF 372

  Fly   389 QNMWIDSLEYEEVGSAIVHRK 409
            ::|.:...:|||.|.::...|
Mouse   373 EDMVVTREDYEENGHSVCEEK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 113/411 (27%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 113/411 (27%)
Actr6NP_080190.1 ACTIN 2..394 CDD:214592 113/411 (27%)
COG5277 2..393 CDD:227602 112/409 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.