DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and ACTR3C

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_016868037.1 Gene:ACTR3C / 653857 HGNCID:37282 Length:280 Species:Homo sapiens


Alignment Length:261 Identity:88/261 - (33%)
Similarity:123/261 - (47%) Gaps:58/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 MFEHFQVPAFYVAVQAVLSLYA--TGRTV------GIVVDSGDGVTHTVPIYEGFALPHACVRVD 219
            |||.|.||..|:||||||:|.|  |.|.|      |||:||||||||.:|:.||:.:......:.
Human     1 MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIP 65

  Fly   220 LAGRDLTDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGKVETYELPDGQK- 283
            :||||:|.::.:||.||.|.:......|..:.||||.||:..:..||.      ..|:: |.|| 
Human    66 IAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEF------AKYDV-DPQKW 123

  Fly   284 ----------------IVLGCERFRCPEALFQPSLLGQEVM-GIHEATHHSITNCDMDLRKDMYA 331
                            |.:|.|||..||..|.|.....:.| .|.:.....|.||.:|:|:.:|.
Human   124 IKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYK 188

  Fly   332 NI-VLSG---------GTTMFRN-------IEHRF-----LQDLT--EMAPPSIR-IKVNASPDR 371
            .: ||.|         |:..::|       |..||     .|:|:  .:.||..| ::...||..
Human   189 VLGVLPGRYRDHPMRYGSGSWQNLLCHLPTIPGRFGGWSPAQELSGLRILPPLHRSLQRGGSPRA 253

  Fly   372 R 372
            |
Human   254 R 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 88/261 (34%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 88/261 (34%)
ACTR3CXP_016868037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.