DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and actrt2

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001006111.1 Gene:actrt2 / 448563 XenbaseID:XB-GENE-22041684 Length:375 Species:Xenopus tropicalis


Alignment Length:368 Identity:179/368 - (48%)
Similarity:246/368 - (66%) Gaps:3/368 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 HHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGILTLK 109
            |..||:.|.|||.||||.|.||.|.||.||:||.....:.:|.:......:||.|..||.||.|.
 Frog     8 HKPAVIFDIGSGNCKAGMSGEDLPTAVVPSVVGHLSDRSAMLGAGQQPYYVGEMAMSKRAILDLV 72

  Fly   110 YPIEHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFY 173
            :||:.|:||:||.|..:|::.|:. |:....:.|..||||||||.:||.||.||.||:|.|||.|
 Frog    73 FPIKEGIVKSWDNMIKIWKYLYKYELKKPSSEHPVFLTEAPLNPLRNRHKMAEIFFENFNVPAMY 137

  Fly   174 VAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGV 238
            |:.||.|:|||:|.|.|||:|.|.|:||||.||:|.|||||..::.:|||.:|.||.|||.|.|.
 Frog   138 VSHQANLALYASGLTTGIVLDVGAGITHTVAIYDGVALPHAVSKLPVAGRTITQYLMKLLTENGY 202

  Fly   239 TMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGK--VETYELPDGQKIVLGCERFRCPEALFQPS 301
            ...|:|||||||:|||||||::::.:.|.:.:.|  .:.|.||||..|.:..:.||.|||||.||
 Frog   203 NFITAAEREIVRDIKEKLCYIALDPSAEYERNPKDITKEYTLPDGNVIKIDSQLFRAPEALFSPS 267

  Fly   302 LLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVN 366
            .:|.|..|:....::.|..|.:|:|:.:.:|:|||||:|:|...:.|.|::|.:.||..::|||.
 Frog   268 NIGLEAPGVQGLINNIIQKCPIDIRRALLSNVVLSGGSTLFPGFDERVLRELEKKAPDGVQIKVL 332

  Fly   367 ASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRK 409
            |:.||::|||.|.|||:|:.||:..||...||:|.|.:|||:|
 Frog   333 AATDRKYSVWIGASVLSSMDSFKENWIRKSEYDEFGPSIVHQK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 178/367 (49%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 178/366 (49%)
actrt2NP_001006111.1 ACTIN 9..375 CDD:214592 177/365 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.