DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and actl6a

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_989337.1 Gene:actl6a / 394962 XenbaseID:XB-GENE-491948 Length:429 Species:Xenopus tropicalis


Alignment Length:434 Identity:139/434 - (32%)
Similarity:220/434 - (50%) Gaps:65/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MSSEVDSNSHHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAA 100
            ||..|.......|:|.|.||...:||::.||.|:..||:.:|      |::|...|.:.:.....
 Frog     1 MSGGVYGGDEVGALVFDIGSYSVRAGYAGEDCPKVDFPTTIG------VVIDREDGSTPMETDGD 59

  Fly   101 RKRGILTLKY-----------------PIEHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTE 147
            :.:......|                 |:::||:::||..:.:..|||:. ::::....|.|::|
 Frog    60 QNKSRSPTYYIDTNSLRVPRENMEAFSPLKNGMIEDWDSFQAIIDHTYKTHIKSETNLHPVLMSE 124

  Fly   148 APLNPKKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALP 212
            |..|.:..|||:||:||||:.:|||::...|||:.:|.||:.|:::|||...|..:|:::|:.|.
 Frog   125 AAWNTRVKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGSTHTTAIPVHDGYVLQ 189

  Fly   213 HACVRVDLAGRDLTDYLCKLLLERGVTM---GTSAEREIVRE-------IKEKLCYVSMNYAKEM 267
            ...|:..|||..:|....:|..|..|.:   ...|.:|.|||       .||||..|:.::...|
 Frog   190 QGIVKSPLAGDFITMQCRELFQEMTVDLIPPYMIASKEAVREGATPNWKRKEKLPQVTRSWHNYM 254

  Fly   268 ------DLHGKV------------------ETYELPDGQKIVLGCERFRCPEALFQPS----LLG 304
                  |....|                  ..||.|:|.....|.||.:.||.||.||    |.|
 Frog   255 CNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSG 319

  Fly   305 QEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKV---N 366
            ..::|:......|:..||:|:|..:|.:::::||.|:.:....|..::|::..|||:|:|:   |
 Frog   320 NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLLQGFTDRLTRELSQKTPPSMRLKLIANN 384

  Fly   367 ASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKC 410
            .:.:||||.|.|||:||||.:||.|||...||||.|...|.|||
 Frog   385 TTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 136/424 (32%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 136/423 (32%)
actl6aNP_989337.1 Actin 11..429 CDD:306521 136/424 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.