DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and actr10

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_956464.1 Gene:actr10 / 393139 ZFINID:ZDB-GENE-040426-768 Length:415 Species:Danio rerio


Alignment Length:391 Identity:94/391 - (24%)
Similarity:158/391 - (40%) Gaps:84/391 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SNSHHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 106
            |.....|||||.|:...|.||:.|..||.:.||.:..|....|                    :.
Zfish     9 SGGEKTAVVIDLGAAYTKCGFAGETGPRFIIPSEIKHPGSQEV--------------------VA 53

  Fly   107 TLKYPIEHGMVKNWDEMEMVWQHTYEL-----LRADPMDLPALLTEAPLNPKKNREKMTEIMFEH 166
            .:::.|      |.:|:..:.:....|     |..:|.|...::.|:.|.|...|:.::.::|.|
Zfish    54 VVQFNI------NTEELYTILKEFIHLLYFRHLLVNPRDRRVVVIESILCPSHYRDTLSRVLFRH 112

  Fly   167 FQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCK 231
            |:||:...|...::|:...|....:|:|.|...|..:|||||..:..|...:.:.|:.:...|..
Zfish   113 FEVPSVLFAPSHLMSIMTLGLQSALVMDCGYTETLVLPIYEGIPILSAWEALPMGGKAIHKELQS 177

  Fly   232 LLLERGVTMGTSAE-------------REIVREIKEKLCYVSMNYAKEMDLHGKVETYELP---- 279
            ||.|: .|:.|.:.             .::|.:||.:.|:||       ||...::..|..    
Zfish   178 LLSEQ-CTVDTDSSTGLQLPSVISHIPEDVVEDIKVRTCFVS-------DLQRGLKIQEAKFNTD 234

  Fly   280 --------------DGQKI--VLGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDLRKD 328
                          |||||  |.|..|....|.||:..   .|...|......::..|.:|.||.
Zfish   235 AERPAPPPDVDYPLDGQKILHVKGFIRDSVAEMLFEQD---NEEKSIATLLLDTLVKCPIDTRKV 296

  Fly   329 MYANIVLSGGTTMFRNIEHRFLQDLTEMA-PPSIR-------IKVNASPDR-RFSVWTGGSVLAS 384
            :..|:::.|||.|.....||.|.::..:. .|..|       .::::.|.: ..:.|.||::..:
Zfish   297 LSENLLIIGGTAMLPGFLHRLLAEIRSLVEKPKYRDALATKSFRIHSPPAKPNCTAWLGGAIFGA 361

  Fly   385 L 385
            |
Zfish   362 L 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 93/387 (24%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 93/386 (24%)
actr10NP_956464.1 NBD_sugar-kinase_HSP70_actin 12..362 CDD:302596 92/386 (24%)
ACTIN 13..362 CDD:214592 92/385 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.