DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Arp3

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster


Alignment Length:417 Identity:148/417 - (35%)
Similarity:210/417 - (50%) Gaps:62/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AVVIDNGSGVCKAGFSPEDTPRAVFPSIVG----------RPRHLNVLLDSVIGDSVIGEAAARK 102
            |.|||.|:|..|.||:....|:.:.||.:.          ..|.:...::.:  |..||:.|...
  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDL--DFFIGDEAFDA 69

  Fly   103 RGILTLKYPIEHGMVKNWDEME-MVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEH 166
            .| .::|||:.||:|::||.|| .:.|..::.|||:|.|...||||.|||..:|||...|||||.
  Fly    70 TG-YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133

  Fly   167 FQVPAFYVAVQAVLSLYAT-------GRTV-GIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGR 223
            |.||..|:||||||:|.|:       .||: ||||||||||||.:|:.||:.:......:.:|||
  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198

  Fly   224 DLTDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGKVETYELPDGQ------ 282
            ::|.::..||.||.|.:......|..:.||||.||:..:.|||.      ..|:...|:      
  Fly   199 NITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEF------AKYDTEPGKWIRNFS 257

  Fly   283 ----------KIVLGCERFRCPEALFQPSLLGQE-VMGIHEATHHSITNCDMDLRKDMYANIVLS 336
                      .:.:|.|||..||..|.|.....: .:.:.|...:.|.||.:|:|:.:|.|||||
  Fly   258 GVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLS 322

  Fly   337 GGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDR----------------RFSVWTGGSVLASL 385
            ||:|||::...|..:|:.......:||..|.|..|                |::||.|||:|||.
  Fly   323 GGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLAST 387

  Fly   386 TSFQNMWIDSLEYEEVGSAIV-HRKCF 411
            ..|..:......|||.|.:|. |...|
  Fly   388 PEFYQVCHTKAAYEEYGPSICRHNPVF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 147/415 (35%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 147/415 (35%)
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 148/417 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.