DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actr1b

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001034117.2 Gene:Actr1b / 316333 RGDID:1307380 Length:376 Species:Rattus norvegicus


Alignment Length:365 Identity:192/365 - (52%)
Similarity:262/365 - (71%) Gaps:2/365 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYPIE 113
            |||||||||.||||:.:..|:..||:.||||:|:.|:..::.||..||..|...||:||::||:|
  Rat    12 VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPME 76

  Fly   114 HGMVKNWDEMEMVWQHTY--ELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFYVAV 176
            ||:|::|::||.:||:.|  :.|:....:.|.|||||||||.|||||..|:.||.|.|||.::::
  Rat    77 HGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISM 141

  Fly   177 QAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMG 241
            ||||||||||||.|:|:||||||||.||||||||:||:.:|||:||||::.||..||.:.|....
  Rat   142 QAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGADFH 206

  Fly   242 TSAEREIVREIKEKLCYVSMNYAKEMDLHGKVETYELPDGQKIVLGCERFRCPEALFQPSLLGQE 306
            ||||.|:||.|||:.||:|:|..|:..|..:...|.||||..:.:|..|||.||.||||.|:|.|
  Rat   207 TSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDE 271

  Fly   307 VMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDR 371
            ..|:||....:|...|||||:.:::|||||||:|:|:....|.|.::.::||..::||::|..:|
  Rat   272 SEGLHEVLAFAIHKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIKISAPQER 336

  Fly   372 RFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            .:|.|.|||:||||.:|:.||:...||||.||..:|||.|
  Rat   337 LYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 191/363 (53%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 191/363 (53%)
Actr1bNP_001034117.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 191/363 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.