DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actl11

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001019959.2 Gene:Actl11 / 316000 RGDID:1310036 Length:1218 Species:Rattus norvegicus


Alignment Length:373 Identity:143/373 - (38%)
Similarity:210/373 - (56%) Gaps:38/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AAVVIDNGSGVCKAGFSPEDTPRAVFPSIV--------GRPRHLNVLLDSVIGDSVIGEAAARKR 103
            ||:|||.|:|..|.|.:.|:...:|.||.|        |:|::       |:.:...|..:...|
  Rat   870 AAIVIDTGTGFTKCGLAQENHVLSVVPSQVQMLQHPPQGQPQY-------VVPEHQEGSYSVLNR 927

  Fly   104 GILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHF 167
            |:           |.:||.:|::|||. |..||..|.::..|:.::|::|:.||||:.||:||.|
  Rat   928 GV-----------VSDWDALEVLWQHLFYCKLRVQPEEMAVLVADSPISPRTNREKVAEILFERF 981

  Fly   168 QVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKL 232
            .|||.....||:|:|||.|||.|:||.||.|.::..||..|...|....|:|:||.||||||.:|
  Rat   982 HVPAMQTVHQALLTLYAYGRTTGLVVGSGHGTSYVAPIITGDLAPLDTYRLDVAGADLTDYLAQL 1046

  Fly   233 LLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLH-GKVET-YELPDGQKIVLGCERFRCPE 295
            |:..|   .:..:..|||:|||..|||:|:...||..: .:|:. :.|||...|.||.|||.|||
  Rat  1047 LMSGG---HSPPKGGIVRQIKEACCYVAMDTTTEMARNQSQVQVDFVLPDKHVITLGSERFCCPE 1108

  Fly   296 ALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPS 360
            |||||:|||...:|:.:....||:..::..::.:.||:||.||:|:......|..|:|...|   
  Rat  1109 ALFQPNLLGLNQLGLPQLALLSISRLEVKQQEQLLANVVLEGGSTLINGFPERMRQELGPGA--- 1170

  Fly   361 IRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHR 408
               .|..||.|..:.|.|||::|...|||::|:...||||.|...:::
  Rat  1171 ---TVLGSPHRAVAAWLGGSIMACRDSFQSLWLSRREYEEEGPWAIYK 1215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 143/373 (38%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 143/373 (38%)
Actl11NP_001019959.2 PHA03247 <200..485 CDD:223021
NBD_sugar-kinase_HSP70_actin 871..1215 CDD:418402 142/370 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.