DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actr6

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006241305.1 Gene:Actr6 / 314718 RGDID:1304609 Length:410 Species:Rattus norvegicus


Alignment Length:345 Identity:99/345 - (28%)
Similarity:163/345 - (47%) Gaps:56/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PIEHGMVKNWDEMEMVWQHTY--ELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFY 173
            |.:.|.:.|||....||.:.:  |:.:.|.:|...::||...|....:|.|.||:||.:|     
  Rat    73 PFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQ----- 132

  Fly   174 VAVQAVLSLYATGRTVG------------IVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLT 226
              .||||.:.|...:..            |:||||...||.||.........|.:|:::.|:.||
  Rat   133 --FQAVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLT 195

  Fly   227 DYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMD---LHGKVET----YELPD---- 280
            ::|.:::..|  .:....|..::.::||.:||||.::.::||   |.|:..|    |.|||    
  Rat   196 NHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEDNTVMIDYVLPDFSTI 258

  Fly   281 -------------------GQKIV-LGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDL 325
                               |::|: |..|||..||.||.||.:|.:.|||.||..:||.|...::
  Rat   259 KKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEM 323

  Fly   326 RKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDRRFSV-WTGGSVLASLTSFQ 389
            :...:.||||:||.::|.....|...::..:.|....:.| ..|:...:. |.||.:::....|:
  Rat   324 QPHFFKNIVLTGGNSLFPGFRERVYSEVRCLTPTDYDVSV-VLPENPITYSWEGGKLISENDDFE 387

  Fly   390 NMWIDSLEYEEVGSAIVHRK 409
            :|.:...:|||.|.::...|
  Rat   388 DMVVTREDYEENGHSVCEEK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 99/345 (29%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 99/345 (29%)
Actr6XP_006241305.1 COG5277 37..407 CDD:227602 98/343 (29%)
ACTIN 38..408 CDD:214592 99/345 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.