DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and ACTL9

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_848620.3 Gene:ACTL9 / 284382 HGNCID:28494 Length:416 Species:Homo sapiens


Alignment Length:403 Identity:161/403 - (39%)
Similarity:239/403 - (59%) Gaps:25/403 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NILHKYLHLPTSPGNMSSEVDSNSHHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVG-RPRHLNV 84
            |:::|.|. ..|||.::..:...:  .|||||.|:|.||.||:.:.:|.....:|:| :|:.   
Human    27 NVVNKPLQ-RDSPGMVADRLPPKT--GAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKK--- 85

  Fly    85 LLDSVIGDS----VIGEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHTYEL-LRADPMDLPAL 144
              .:..|.|    .||| |||....|||..|:..|:|.:||..|::|:|..|. ||....|.|.|
Human    86 --PATSGQSGLQTFIGE-AARVLPELTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLL 147

  Fly   145 LTEAPLNPKKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGF 209
            .::.|.:|..||||:.|:.||..:.||.|||.|:|||:||.||..|:|||:|.|||:|||:::|:
Human   148 FSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGY 212

  Fly   210 ALPHACVRVDLAGRDLTDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGKVE 274
            .|.||..|:||||.:||.:|.::||:.|:.:| ..:.::|..||...|||:.::.||   ..:.|
Human   213 NLLHATERLDLAGNNLTAFLAEMLLQAGLPLG-QQDLDLVENIKHHYCYVASDFQKE---QARPE 273

  Fly   275 -----TYELPDGQKIVLGCERFRCPEALFQ-PSLLGQEVMGIHEATHHSITNCDMDLRKDMYANI 333
                 |.:||||:.:.||.|.|:|||.||. |.:.|...:|:......|:....:::|.|:..|:
Human   274 QEYKRTLKLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQNV 338

  Fly   334 VLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSLEY 398
            :|.||:::|...|.||..:|....|....:.|.|.|.|.||||.|||:||||.:||:.|:...:|
Human   339 LLCGGSSLFTGFEGRFRAELLRALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSCWVLREQY 403

  Fly   399 EEVGSAIVHRKCF 411
            ||.|..||:|||:
Human   404 EEQGPYIVYRKCY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 154/376 (41%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 154/375 (41%)
ACTL9NP_848620.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 2/6 (33%)
NBD_sugar-kinase_HSP70_actin 49..416 CDD:302596 154/378 (41%)
ACTIN 49..415 CDD:214592 153/377 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.