DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and SPBC56F2.03

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_596714.1 Gene:SPBC56F2.03 / 2540863 PomBaseID:SPBC56F2.03 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:53/275 - (19%)
Similarity:97/275 - (35%) Gaps:63/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 KKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPH---- 213
            :|.::::.:.:|....||........:.::.:|.....|:||.|...|..:.|.:...|.|    
pombe    79 RKQKKELCDGLFNTLNVPITLWICAPLTAILSTSTRDAIIVDIGMKETKFIVILDLCILMHYTKT 143

  Fly   214 -------------ACVRVD--------LAGRD--LTDYLCKLLLERGVTMGTSAEREIVREIKEK 255
                         .|.:::        |...:  :|:.|.|.||:..|   .|...|.:.::.::
pombe   144 SKRSLSTVLERMADCFKLNNKKNSQKLLEDEEFAVTEALMKSLLKSRV---PSKPTEELYQLTDQ 205

  Fly   256 LCYVSMNYAKEMDL-HGKVETYELPDGQKIVLGCERFRCP--------EALFQPSLLGQEVMGIH 311
            ..|  ..|:..:.| ....:|.:...|... ...|:.|.|        ||||:.|..|..     
pombe   206 EAY--FRYSDILPLAETTCQTNKTERGSSF-NDAEKIRVPSWIANAGIEALFEGSDAGGS----- 262

  Fly   312 EATHHSITN--------CDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNAS 368
            :....::.|        ..:|:|:.|...||.:|..........||..::|     |..:.:.|.
pombe   263 DIADQALPNVLLSLYRILPIDIRRIMSKLIVFNGILPSLPGWYQRFQNEMT-----SRGLAIKAV 322

  Fly   369 PDRR---FSVWTGGS 380
            |.:.   ...|.|.|
pombe   323 PGQTTADMMAWNGAS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 53/275 (19%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 53/275 (19%)
SPBC56F2.03NP_596714.1 NBD_sugar-kinase_HSP70_actin <69..338 CDD:302596 53/275 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.