DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and ACTL10

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001019846.1 Gene:ACTL10 / 170487 HGNCID:16127 Length:245 Species:Homo sapiens


Alignment Length:243 Identity:83/243 - (34%)
Similarity:131/243 - (53%) Gaps:11/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGV 238
            :|..|:|:|.:||...|:.|::|.||.|..|||.|.:...|..|:::||..|:.||..||:....
Human     1 MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANP 65

  Fly   239 TMGTSA-EREIVREIKEKLCYVSMNYAKEMDLHGKVE----TYELPDGQKIVLGCERFRCPEALF 298
            .:...| .|:.:..:|::.||||:::  |.||.....    ::.:.:|..:.|..|||||||.:|
Human    66 DLLQQALPRKAITHLKKRSCYVSLDF--EGDLRDPARHHPASFSVGNGCCVCLSSERFRCPEPIF 128

  Fly   299 QPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAP----P 359
            ||.||||...|:......::......||..:...:||:||:|:|.....|..::|.....    .
Human   129 QPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQCRRHGYA 193

  Fly   360 SIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVH 407
            ::|..:.|...|..:||||||::|||.|||..||....|:|.||.:::
Human   194 ALRPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECGSRLLY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 83/243 (34%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 83/243 (34%)
ACTL10NP_001019846.1 NBD_sugar-kinase_HSP70_actin <2..237 CDD:327376 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.