DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and ACTRT2

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_536356.3 Gene:ACTRT2 / 140625 HGNCID:24026 Length:377 Species:Homo sapiens


Alignment Length:376 Identity:171/376 - (45%)
Similarity:240/376 - (63%) Gaps:13/376 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HA----AVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDS---VIGEAAARKR 103
            ||    ||:.|||||.||||.|.|..||.:..||||   ||.....|...:.   .:||.|..|:
Human     5 HALDSPAVIFDNGSGFCKAGLSGEFGPRHMVSSIVG---HLKFQAPSAEANQKKYFVGEEALYKQ 66

  Fly   104 GILTLKYPIEHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTEAPLNPKKNREKMTEIMFEHF 167
            ..|.|..|.|.|::..||::|.:|:|.:|. |...|.|.|.|.||..|||::|||||.|:|||:|
Human    67 EALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFENF 131

  Fly   168 QVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKL 232
            .|||||::.||||:|||:....|:||||||.||.||||:||::||||..::.:||||:|:.|.:|
Human   132 GVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQL 196

  Fly   233 LLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGK--VETYELPDGQKIVLGCERFRCPE 295
            ||..|.|.....::.:|.:||:|||||::...||:....:  :..|:||||..|.||....:.||
Human   197 LLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPE 261

  Fly   296 ALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPS 360
            |||.|..||.:..|:......|||.||.|::|.::..||||||||:|..::.|.|::|.::|...
Human   262 ALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIVLSGGTTLFHGLDDRLLKELEQLASKD 326

  Fly   361 IRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            ..||:.|.|||.||.|.|.|::.||:||:.||:.:.:::|.|:::|.|:||
Human   327 TPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 169/374 (45%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 168/373 (45%)
ACTRT2NP_536356.3 ACTIN 10..377 CDD:214592 167/369 (45%)
NBD_sugar-kinase_HSP70_actin 11..377 CDD:302596 167/368 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.