DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and LOC102552318

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_038957224.1 Gene:LOC102552318 / 102552318 RGDID:7506405 Length:383 Species:Rattus norvegicus


Alignment Length:365 Identity:147/365 - (40%)
Similarity:212/365 - (58%) Gaps:23/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PRAVFPSIVGRPRHLNVLLDSVIGDSV-----------------IGEAAARKRGILTLKYPIEHG 115
            |.|.||  ||....|....||.:.||:                 ||......|..|.:.|||..|
  Rat    21 PLARFP--VGLAPALGSRSDSYVQDSLLPFLQTLLERLEEEDWFIGAEVQNNRPKLNIHYPIFRG 83

  Fly   116 MVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFYVAVQAV 179
            .:.|||.::.||.:: |..||..|...|.|:|:.||..|:.|.|||:|:||.|..||.|:|.|.|
  Rat    84 AITNWDNVQKVWHYSFYHYLRIAPEQHPILVTDPPLTTKEARSKMTQILFETFNFPALYLANQGV 148

  Fly   180 LSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMGTSA 244
            |||||:|||.|..::||||:|:.|||..|:.|..:..:||.||:|||.||.|||.:.|..:.|:|
  Rat   149 LSLYASGRTSGTTIESGDGMTYFVPIANGYPLHLSTTKVDTAGQDLTVYLMKLLSDNGNMLETTA 213

  Fly   245 EREIVREIKEKLCYVSMNYAKEMDLHGK---VETYELPDGQKIVLGCERFRCPEALFQPSLLGQE 306
            :.|.||::|||.|||:::|..||....:   ::.:.||||::|.||.|.|.|||.||.|||:|:.
  Rat   214 DLEHVRDLKEKCCYVALDYDMEMSKTSESSFLKKFTLPDGKEISLGQETFMCPEVLFNPSLVGKN 278

  Fly   307 VMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDR 371
            ..||......|||:||....::::..|:|||||.....:..|..:::.::..|.:.:||..||..
  Rat   279 YPGIDMQAQQSITSCDKSHWRNLFGYIILSGGTGTCSGLRFRLQREIAKLVSPELSVKVVTSPYA 343

  Fly   372 RFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            ::..|.|.|:|.||..|::|||.:.||.|:|.:::.|:.|
  Rat   344 KYGAWVGASILCSLPMFKDMWITNHEYLEIGPSVICRRTF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 146/363 (40%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 146/363 (40%)
LOC102552318XP_038957224.1 NBD_sugar-kinase_HSP70_actin 57..383 CDD:418402 135/325 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.