DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actl10

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:341 Identity:114/341 - (33%)
Similarity:177/341 - (51%) Gaps:29/341 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LLDSVIGDSVIGEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQH-TYELLRADPMDLPALLTEA 148
            :|..|.|..:.|..|.        .:||:||:|.:||.:|.:|:. ....|:..|...|.|::::
  Rat     8 VLPGVPGCELAGGVAR--------AHPIKHGVVVDWDALEGLWERLMVGGLQIHPEQWPVLVSDS 64

  Fly   149 PLNPKKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPH 213
            |..|.:.|||:.|::||...|||.::|..|:|:|.:.|...|:.|::|.||.|..|||.|.:...
  Rat    65 PSAPPEGREKVAELLFEALTVPACHMASTALLALCSVGAFSGLAVEAGAGVCHATPIYAGHSWHK 129

  Fly   214 ACVRVDLAGRDLTDYLCKLLLERGVTMGTSA-EREIVREIKEKLCYVSMNYAKEMDLHGKV---- 273
            |..|:::||..|:.|...||:.....:...| .|:.|.::|::.||||      :|..|.:    
  Rat   130 ATFRLNVAGSTLSRYFRDLLVASCPDLQLHALPRKTVTQLKKRCCYVS------LDFQGDICDPA 188

  Fly   274 ----ETYELPDGQKIVLGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIV 334
                ..:.|..|..:.||.|||||||.:|||||||....|:......::......||..:...:|
  Rat   189 RHQRACFCLGKGCYVRLGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVV 253

  Fly   335 LSGGTTMFRNIEHRFLQDLTEMAP----PSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDS 395
            |:||:|:|.....|...:|.....    |:::..:.|.|.|..:||||||::|||.|||..|:..
  Rat   254 LAGGSTLFPGFVERMNLELQAQCRRHGYPALQPCLVAHPGRGTAVWTGGSMMASLHSFQRRWMTR 318

  Fly   396 LEYEEVGSAIVHRKCF 411
            ..|:|.|..:| |:.|
  Rat   319 AMYQEYGPFLV-REVF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 113/339 (33%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 113/339 (33%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 106/309 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.