DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and SOD2

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_011872.1 Gene:SOD2 / 856399 SGDID:S000001050 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:97/220 - (44%)
Similarity:131/220 - (59%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISQTASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEE-----AK 66
            :|..::.|.|.|.|||.|.:|:.||||.|..:|.|||:.||||||||..|.|.:|.:|     ||
Yeast    16 LSLLSTTARRTKVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAK 80

  Fly    67 --SKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNK----TQPSDDLKKAIESQWKSLEEFKK 125
              |.::..|:|.:...::|:|||..||.:||:||:|..    ..|:..|.|||:.|:.||:|..|
Yeast    81 EPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIK 145

  Fly   126 ELTTLTVAVQGSGWGWLGFN-KKSGKLQLAALPNQDPLEASTG-LIPLFGIDVWEHAYYLQYKNV 188
            ...|....||||||.::..| ...|||.:....|||.:   || |:||..||.|||||||||:|.
Yeast   146 LTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTV---TGPLVPLVAIDAWEHAYYLQYQNK 207

  Fly   189 RPSYVEAIWDIANWDDISCRFQEAK 213
            :..|.:|||::.||.:.|.||...|
Yeast   208 KADYFKAIWNVVNWKEASRRFDAGK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 95/211 (45%)
Sod_Fe_N 18..99 CDD:278509 41/87 (47%)
Sod_Fe_C 105..208 CDD:280872 48/104 (46%)
SOD2NP_011872.1 SodA 25..233 CDD:223678 95/211 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I1761
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H530
Inparanoid 1 1.050 173 1.000 Inparanoid score I996
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62294
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 1 1.000 - - oto99523
orthoMCL 1 0.900 - - OOG6_100280
Panther 1 1.100 - - LDO PTHR11404
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1373
SonicParanoid 1 1.000 - - X1932
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.