DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and RSM26

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_012635.1 Gene:RSM26 / 853565 SGDID:S000003862 Length:266 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:60/267 - (22%)
Similarity:100/267 - (37%) Gaps:87/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGKHTLPKLPYDYAALEPIICREIMELHHQK----HHQTYVNN---LNAAEEQLEE-------AK 66
            ||.|.:||||...|.|:..: ..|:.....|    .:|.|:.:   |..|.:.||.       .|
Yeast     6 RGIHVVPKLPNSKALLQNGV-PNILSSSGFKTVWFDYQRYLCDKLTLATAGQSLESYYPFHILLK 69

  Fly    67 SKSD--TTKLIQLAPALRFNGGGHINHTIFWQNLSPN------------KTQPS----DDLKKAI 113
            :..:  .:.:..||.::      |.|| :|.:|:.|:            ||:||    ..:|.:.
Yeast    70 TAGNPLQSNIFNLASSI------HNNH-LFVENILPSAVEHGTNSNAVVKTEPSRLFLSKIKDSF 127

  Fly   114 E-SQWKSLEE---FKKELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDP------------- 161
            . |.|:.::|   ::.|...|     |.||.:|..|.:.....|.:..|..|             
Yeast   128 NGSDWEVVKEEMIYRAENEVL-----GQGWLFLVENNEKKLFILTSNNNGTPYYFPRNQSFDLNS 187

  Fly   162 ----------------LEASTGL--------IPLFGIDVWEHAYYLQY-KNVRPSYVEAIWDIAN 201
                            :..||.|        :|:..:::|:|||...| ...|..||:.:.|..|
Yeast   188 AISIDEFATLKQMKELIGKSTKLNGKVQDWTMPIICVNLWDHAYLHDYGVGNRSKYVKNVLDNLN 252

  Fly   202 WDDISCR 208
            |..::.|
Yeast   253 WSVVNNR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 60/267 (22%)
Sod_Fe_N 18..99 CDD:278509 23/96 (24%)
Sod_Fe_C 105..208 CDD:280872 31/148 (21%)
RSM26NP_012635.1 Sod_Fe_C 115..259 CDD:397070 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.