DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and MRP1

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_010634.3 Gene:MRP1 / 851948 SGDID:S000002755 Length:321 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:38/197 - (19%)
Similarity:60/197 - (30%) Gaps:75/197 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLA 154
            |.||..:.|    |..::.|:.|:.|.:.||.||:..|....:|:.|.|:.||...::..|..:.
Yeast   123 NRTISNEPL----TTGNERLQAALISSFGSLMEFRTLLINSNLAISGDGFTWLVARRQLDKRAMR 183

  Fly   155 -ALPNQD----------------PLEAST------------------------------------ 166
             .:||:|                |...||                                    
Yeast   184 NDMPNRDIEYDKLFILNTYNAGTPFNFSTSGVMNELNNQYTNMEKQRAKEAGNLEDSEMTAKQAK 248

  Fly   167 -----------------GLIPLFGIDVWEHAYYLQYKNV-RPSYVEAIWDIANWDDISCRFQEAK 213
                             ..|||..||.....:...|... :..|:|.:||...|..:..|..:..
Yeast   249 TKFIYETQQKGFSGKEVSYIPLLAIDASPKTWLTDYGVFGKREYLERVWDSIEWKIVESRLPQRT 313

  Fly   214 KL 215
            |:
Yeast   314 KI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 37/194 (19%)
Sod_Fe_N 18..99 CDD:278509 3/8 (38%)
Sod_Fe_C 105..208 CDD:280872 31/173 (18%)
MRP1NP_010634.3 SodA 20..315 CDD:223678 37/195 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.