Sequence 1: | NP_001286503.1 | Gene: | Sod2 / 36878 | FlyBaseID: | FBgn0010213 | Length: | 217 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010634.3 | Gene: | MRP1 / 851948 | SGDID: | S000002755 | Length: | 321 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 197 | Identity: | 38/197 - (19%) |
---|---|---|---|
Similarity: | 60/197 - (30%) | Gaps: | 75/197 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 NHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLA 154
Fly 155 -ALPNQD----------------PLEAST------------------------------------ 166
Fly 167 -----------------GLIPLFGIDVWEHAYYLQYKNV-RPSYVEAIWDIANWDDISCRFQEAK 213
Fly 214 KL 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sod2 | NP_001286503.1 | SodA | 16..214 | CDD:223678 | 37/194 (19%) |
Sod_Fe_N | 18..99 | CDD:278509 | 3/8 (38%) | ||
Sod_Fe_C | 105..208 | CDD:280872 | 31/173 (18%) | ||
MRP1 | NP_010634.3 | SodA | 20..315 | CDD:223678 | 37/195 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0605 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |