DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and FSD2

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_199923.1 Gene:FSD2 / 835183 AraportID:AT5G51100 Length:305 Species:Arabidopsis thaliana


Alignment Length:234 Identity:74/234 - (31%)
Similarity:110/234 - (47%) Gaps:44/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAVRGKHT----LPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLN-----------AAEEQL 62
            :||.|..|    |...||...||||.:.||.::.|..|||:|||.|||           :.||.:
plant    43 VAVSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDALSLEEVV 107

  Fly    63 EEAKSKSDTTKLIQLAPALRFNGGGHI-NHTIFWQNLSP-NKTQPSDDLKKAIESQWKSLEEFKK 125
            ..:.:|.:      :.||  ||..... ||..||:::.| ...:|:.:|.:.||..:.|.|||.:
plant   108 LLSYNKGN------MLPA--FNNAAQAWNHEFFWESIQPGGGGKPTGELLRLIERDFGSFEEFLE 164

  Fly   126 ELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLI----------------PLFGI 174
            ...:...:..||||.||.:  |:.:|.:|...|..|.|....|:                ||..|
plant   165 RFKSAAASNFGSGWTWLAY--KANRLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTI 227

  Fly   175 DVWEHAYYLQYKNVRPSYVEAIWD-IANWDDISCRFQEA 212
            |.|||||||.::|.|..|:....: :.:|:.:|.|.:.|
plant   228 DTWEHAYYLDFENRRAEYINTFMEKLVSWETVSTRLESA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 72/231 (31%)
Sod_Fe_N 18..99 CDD:278509 31/96 (32%)
Sod_Fe_C 105..208 CDD:280872 37/119 (31%)
FSD2NP_199923.1 PLN02685 5..305 CDD:215369 74/234 (32%)
Sod_Fe_N 53..136 CDD:278509 30/90 (33%)
Sod_Fe_C 144..262 CDD:280872 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100280
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.