DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and FSD1

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001190834.1 Gene:FSD1 / 828613 AraportID:AT4G25100 Length:212 Species:Arabidopsis thaliana


Alignment Length:218 Identity:72/218 - (33%)
Similarity:109/218 - (50%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNL-----------NAAEEQLEE 64
            ||.||...:.|...|:...||||.:.::.:|.|..|||:.||:||           ...|..:..
plant     3 ASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHS 67

  Fly    65 AKSKSDTTKLIQLAPALRFNGGGHI-NHTIFWQNLSP-NKTQPSDDLKKAIESQWKSLEEFKKEL 127
            ..:..|      |.||  ||..... ||..||:::.| ...:||.:|...:|..:.|.|:|.:|.
plant    68 TYNNGD------LLPA--FNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKFYEEF 124

  Fly   128 TTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQ-DPLEASTGLIPLFGIDVWEHAYYLQYKNVRPS 191
            ........|:||.||.::.:  ||::...||. :||  ..|..||..||||||||||.::|.||.
plant   125 NAAAATQFGAGWAWLAYSNE--KLKVVKTPNAVNPL--VLGSFPLLTIDVWEHAYYLDFQNRRPD 185

  Fly   192 YVEA-IWDIANWDDISCRFQEAK 213
            |::. :.::.:|:.:|.|.:.||
plant   186 YIKTFMTNLVSWEAVSARLEAAK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 68/213 (32%)
Sod_Fe_N 18..99 CDD:278509 26/92 (28%)
Sod_Fe_C 105..208 CDD:280872 38/104 (37%)
FSD1NP_001190834.1 PLN02184 1..212 CDD:177838 72/218 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100280
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.