DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and MSD1

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_187703.1 Gene:MSD1 / 820263 AraportID:AT3G10920 Length:231 Species:Arabidopsis thaliana


Alignment Length:205 Identity:107/205 - (52%)
Similarity:141/205 - (68%) Gaps:9/205 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISQTAS--LAVRG--KHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKS 67
            :.:|:|  |.:||  ..|||.|||||.||||.|..|||::|||||||.||.|.|.|.|||::|.:
plant    15 LKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVN 79

  Fly    68 KSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNK----TQPSDDLKKAIESQWKSLEEFKKELT 128
            |.|.:.:::|..|::||||||:||:|||:||:|:.    ..|...|..||::.:.|||...|:::
plant    80 KGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMS 144

  Fly   129 TLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTG-LIPLFGIDVWEHAYYLQYKNVRPSY 192
            ....|||||||.|||.:|:..||.:....|||||....| |:||.||||||||||||||||||.|
plant   145 AEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEY 209

  Fly   193 VEAIWDIANW 202
            ::.:|.:.||
plant   210 LKNVWKVINW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 104/194 (54%)
Sod_Fe_N 18..99 CDD:278509 48/80 (60%)
Sod_Fe_C 105..208 CDD:280872 52/99 (53%)
MSD1NP_187703.1 PLN02471 1..231 CDD:215262 107/205 (52%)
Sod_Fe_N 30..111 CDD:278509 48/80 (60%)
Sod_Fe_C 121..224 CDD:280872 52/99 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1975
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H530
Inparanoid 1 1.050 218 1.000 Inparanoid score I1215
OMA 1 1.010 - - QHG62294
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 1 1.000 - - otm3329
orthoMCL 1 0.900 - - OOG6_100280
Panther 1 1.100 - - LDO PTHR11404
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1932
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.