DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and SOD2

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_000627.2 Gene:SOD2 / 6648 HGNCID:11180 Length:222 Species:Homo sapiens


Alignment Length:203 Identity:126/203 - (62%)
Similarity:157/203 - (77%) Gaps:1/203 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQL 77
            |..|.||:||.|||||.||||.|..:||:|||.|||..||||||..||:.:||.:|.|.|..|.|
Human    20 LGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIAL 84

  Fly    78 APALRFNGGGHINHTIFWQNLSPN-KTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGW 141
            .|||:|||||||||:|||.||||| ..:|..:|.:||:..:.|.::||::||..:|.||||||||
Human    85 QPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGW 149

  Fly   142 LGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWDDIS 206
            |||||:.|.||:||.||||||:.:||||||.||||||||||||||||||.|::|||::.||::::
Human   150 LGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVT 214

  Fly   207 CRFQEAKK 214
            .|:...||
Human   215 ERYMACKK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 123/198 (62%)
Sod_Fe_N 18..99 CDD:278509 53/80 (66%)
Sod_Fe_C 105..208 CDD:280872 64/102 (63%)
SOD2NP_000627.2 SodA 23..222 CDD:223678 123/198 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148075
Domainoid 1 1.000 152 1.000 Domainoid score I4328
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H530
Inparanoid 1 1.050 277 1.000 Inparanoid score I2947
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62294
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 1 1.000 - - oto89750
orthoMCL 1 0.900 - - OOG6_100280
Panther 1 1.100 - - LDO PTHR11404
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1932
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.