DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and sod2

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001005694.1 Gene:sod2 / 448200 XenbaseID:XB-GENE-1000989 Length:224 Species:Xenopus tropicalis


Alignment Length:200 Identity:126/200 - (63%)
Similarity:158/200 - (79%) Gaps:1/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQLAPA 80
            |.|||||.|||||.||:|.|..|||:|||.|||.|||||||..||:..||.:|.|.|..:.|..|
 Frog    25 REKHTLPDLPYDYGALQPHISAEIMQLHHSKHHATYVNNLNITEEKYAEALAKGDVTTQVSLQAA 89

  Fly    81 LRFNGGGHINHTIFWQNLSPN-KTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGF 144
            |:|||||||||||||.||||| ..:|..:|..||:..:.|.|:||::|:|::|.||||||||||:
 Frog    90 LKFNGGGHINHTIFWTNLSPNGGGEPQGELLDAIKRDFGSFEKFKEKLSTVSVGVQGSGWGWLGY 154

  Fly   145 NKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWDDISCRF 209
            ||:|.:|||||..|||||:.:||||||.||||||||||||||||||.|::|||::.||::::.|:
 Frog   155 NKESNRLQLAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYMKAIWNVINWENVAERY 219

  Fly   210 QEAKK 214
            :.:||
 Frog   220 RASKK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 124/198 (63%)
Sod_Fe_N 18..99 CDD:278509 54/80 (68%)
Sod_Fe_C 105..208 CDD:280872 64/102 (63%)
sod2NP_001005694.1 SodA 27..224 CDD:223678 123/196 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H530
Inparanoid 1 1.050 276 1.000 Inparanoid score I2876
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 1 1.000 - - oto103562
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1373
SonicParanoid 1 1.000 - - X1932
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.