DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and SPBC3H7.04

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_595771.1 Gene:SPBC3H7.04 / 2540925 PomBaseID:SPBC3H7.04 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:47/189 - (24%)
Similarity:84/189 - (44%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HQTYVNNLNAAEEQLEEAKSKSDTTKLIQLA--PALR--FNGGGH-INHTIFWQNL-SPNKTQPS 106
            :..::..|...|.::.:...:..:..::|.|  ||..  ||.... :||..|:..| ||.:  ||
pombe    30 YDNHLRGLVQKECKIHQTPYRVPSDLMVQSASDPARANLFNYSSQLVNHDFFFSGLISPER--PS 92

  Fly   107 DD-------LKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQD---- 160
            .|       ||..|::.:.|..|.|.::..:..:|.|.||.||.::.:.....|....|..    
pombe    93 ADADLGAINLKPGIDASFGSFGELKSQMVDVGNSVFGDGWLWLVYSPEKSLFSLLCTYNASNAFL 157

  Fly   161 -----PLEASTGLIPLFGIDVWEHAYYLQY-KNVRPSYVEAIWDIANWDDISCRFQEAK 213
                 |...:..::||..:::|::||...| .|.:..|:...||:.||..::.|||..:
pombe   158 WGTGFPKFRTNAIVPLLCVNLWQYAYLDDYGLNGKKMYITKWWDMINWTVVNNRFQATR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 47/189 (25%)
Sod_Fe_N 18..99 CDD:278509 12/56 (21%)
Sod_Fe_C 105..208 CDD:280872 30/119 (25%)
SPBC3H7.04NP_595771.1 SodA 1..218 CDD:223678 47/189 (25%)
Sod_Fe_C 102..211 CDD:280872 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.