DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and SPBC16A3.14

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_596775.2 Gene:SPBC16A3.14 / 2539915 PomBaseID:SPBC16A3.14 Length:268 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:48/227 - (21%)
Similarity:91/227 - (40%) Gaps:40/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLN--AAEEQLEEAKSKS---DTTKLIQLA 78
            ||:|.|  ....|.|:...|.:::...:|.:..|..||  ....:||::...:   .|..|.:.|
pombe    39 HTVPNL--SQRNLLPLFSPEALDIAWDQHQRQVVKELNDRVKGTELEDSSVFNIIFQTAALPEHA 101

  Fly    79 PALRFNGGGHINHTIFWQNL---------SPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAV 134
            ...:|....:.|| .|:|:|         ..:|.:.:..:.||:...:.|.|....::..|....
pombe   102 ATFQFASQAYNNH-FFFQSLIGKRAADAKKNSKYEANAAINKAVNENFGSKENLLSKIHELASNS 165

  Fly   135 QGSGWGWL---GFNK-------KSGKLQL------------AALPNQDPLEASTGLIPLFGIDVW 177
            .|:.|.|:   .:|:       ::|...|            :::|:..........:|:..:.:|
pombe   166 FGACWLWIVIDDYNRLNLLRTFQAGSPYLWTRWQSNDPHLISSVPDYSARPRKYAHVPILNLCLW 230

  Fly   178 EHAYYLQYKNV-RPSYVEAIWDIANWDDISCR 208
            .||||..|..: |..|::..:|..:|..|..|
pombe   231 NHAYYKDYGLLNRSRYIDTWFDCIDWSVIEER 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 48/227 (21%)
Sod_Fe_N 18..99 CDD:278509 22/93 (24%)
Sod_Fe_C 105..208 CDD:280872 24/125 (19%)
SPBC16A3.14NP_596775.2 SodA 39..267 CDD:223678 48/227 (21%)
Sod_Fe_N 49..120 CDD:278509 17/71 (24%)
Sod_Fe_C 139..262 CDD:280872 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.