DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and Sod2

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_058747.1 Gene:Sod2 / 24787 RGDID:3732 Length:222 Species:Rattus norvegicus


Alignment Length:212 Identity:129/212 - (60%)
Similarity:162/212 - (76%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKISQTASLA-VRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSK 68
            |::...||.| .|.||:||.|||||.||||.|..:||:|||.|||.|||||||..||:..||.:|
  Rat    11 RRLGPAASTAGSRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLNVTEEKYHEALAK 75

  Fly    69 SDTTKLIQLAPALRFNGGGHINHTIFWQNLSP-NKTQPSDDLKKAIESQWKSLEEFKKELTTLTV 132
            .|.|..:.|.|||:|||||||||:|||.|||| ...:|..:|.:||:..:.|.|:||::||.::|
  Rat    76 GDVTTQVALQPALKFNGGGHINHSIFWTNLSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSV 140

  Fly   133 AVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIW 197
            .|||||||||||||:.|:||:||..|||||:.:||||||.||||||||||||||||||.|::|||
  Rat   141 GVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIW 205

  Fly   198 DIANWDDISCRFQEAKK 214
            ::.||:::|.|:...||
  Rat   206 NVINWENVSQRYIVCKK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 123/198 (62%)
Sod_Fe_N 18..99 CDD:278509 53/80 (66%)
Sod_Fe_C 105..208 CDD:280872 65/102 (64%)
Sod2NP_058747.1 SodA 25..217 CDD:223678 121/192 (63%)
Sod_Fe_N 25..106 CDD:278509 53/80 (66%)
Sod_Fe_C 113..216 CDD:280872 65/102 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341949
Domainoid 1 1.000 153 1.000 Domainoid score I4213
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H530
Inparanoid 1 1.050 275 1.000 Inparanoid score I2881
OMA 1 1.010 - - QHG62294
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 1 1.000 - - oto96863
orthoMCL 1 0.900 - - OOG6_100280
Panther 1 1.100 - - LDO PTHR11404
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1932
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.