DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod2 and sod-3

DIOPT Version :9

Sequence 1:NP_001286503.1 Gene:Sod2 / 36878 FlyBaseID:FBgn0010213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_510764.1 Gene:sod-3 / 181748 WormBaseID:WBGene00004932 Length:218 Species:Caenorhabditis elegans


Alignment Length:213 Identity:130/213 - (61%)
Similarity:159/213 - (74%) Gaps:5/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ARKISQTAS--LAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAK 66
            |.|:.|..:  ||||.|||||.||:|||.|||:|..|||:|||||||.|||||||..||:|.||.
 Worm     9 ASKLVQPVAGVLAVRSKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAV 73

  Fly    67 SKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLT 131
            ||.:..:.|.|.|||:|||||||||:|||.||:.:..:||.:|...|:..:.||:..:|.|:.:|
 Worm    74 SKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDIT 138

  Fly   132 VAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAI 196
            :|||||||||||:.||...|::|...||||||   |::|||||||||||||||||||||.||.||
 Worm   139 IAVQGSGWGWLGYCKKDKILKIATCANQDPLE---GMVPLFGIDVWEHAYYLQYKNVRPDYVHAI 200

  Fly   197 WDIANWDDISCRFQEAKK 214
            |.||||.:||.||..|::
 Worm   201 WKIANWKNISERFANARQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod2NP_001286503.1 SodA 16..214 CDD:223678 124/197 (63%)
Sod_Fe_N 18..99 CDD:278509 56/80 (70%)
Sod_Fe_C 105..208 CDD:280872 63/102 (62%)
sod-3NP_510764.1 PLN02471 5..216 CDD:215262 129/209 (62%)
Sod_Fe_N 25..106 CDD:278509 56/80 (70%)
Sod_Fe_C 112..212 CDD:280872 63/102 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160012
Domainoid 1 1.000 146 1.000 Domainoid score I2790
eggNOG 1 0.900 - - E1_COG0605
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H530
Inparanoid 1 1.050 276 1.000 Inparanoid score I1775
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62294
OrthoDB 1 1.010 - - D1353361at2759
OrthoFinder 1 1.000 - - FOG0002017
OrthoInspector 1 1.000 - - otm14241
orthoMCL 1 0.900 - - OOG6_100280
Panther 1 1.100 - - O PTHR11404
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1373
SonicParanoid 1 1.000 - - X1932
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.