DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5348 and slc8b1

DIOPT Version :9

Sequence 1:NP_611156.3 Gene:CG5348 / 36877 FlyBaseID:FBgn0034156 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001017082.1 Gene:slc8b1 / 549836 XenbaseID:XB-GENE-957176 Length:238 Species:Xenopus tropicalis


Alignment Length:244 Identity:61/244 - (25%)
Similarity:107/244 - (43%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDTKTTKS----DVFTVKNALDAEFDNFWKTVSCFAANNFPFEERCEFVQKAEDCNSSTNVIPYM 64
            |.|.|:||    :.......|:..|::......|..........||.|.:...||:.....|.|:
 Frog     9 IVTSTSKSQGSAEFLIGMEPLNYSFNSVQNKADCQEVGKLDASLRCNFTRTTPDCSVGDGYINYL 73

  Fly    65 RLLACDLKCINQFQEMIF---IALFVAFCFQILVLLIYTINVYYSPALKAVSRFLHMNEHLAGVT 126
            ....|      .|...:|   |.|:..:...:.::|..|...::.|.|.|:||.|.::.::||||
 Frog    74 DGAFC------SFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVT 132

  Fly   127 LMAFGNTSADFFANLASVERHVPVFANNLSSAL----------FVITISGGLIFYISPFKMNSYE 181
            .:||||.:.|.|:.:|:       |:::.::.|          ||.|:..|.|..:.||...|..
 Frog   133 FLAFGNGAPDVFSAVAA-------FSDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRP 190

  Fly   182 TVRDILFLLLATLLMDYFAYTTNHFALGYEFKFFIVLLVYISYIIINVA 230
            .:|||:|.:.| :.:.:|........|.....:.::.|||:..::|:.|
 Frog   191 FLRDIVFYISA-IFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5348NP_611156.3 Na_Ca_ex 86..>186 CDD:279963 30/109 (28%)
Na_Ca_ex 458..603 CDD:279963
slc8b1NP_001017082.1 Na_Ca_ex 94..219 CDD:279963 36/132 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8955
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41602
Inparanoid 1 1.050 205 1.000 Inparanoid score I3626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X612
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.