DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5348 and Slc24a1

DIOPT Version :9

Sequence 1:NP_611156.3 Gene:CG5348 / 36877 FlyBaseID:FBgn0034156 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_659062.1 Gene:Slc24a1 / 214111 MGIID:2384871 Length:1130 Species:Mus musculus


Alignment Length:242 Identity:53/242 - (21%)
Similarity:107/242 - (44%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FIALFVAFCFQILVLLIYTINVYYSPALKAVSRFLHMNEHLAGVTLMAFGNTSADFFANLASVER 146
            ::.|.:.....:.|.|....:.|:.|||..::..|.::|.:||.|.||.|.::.:.|.:|     
Mouse   421 WVVLHIFGMMYVFVALAIVCDEYFVPALGVITHKLQISEDVAGATFMAAGGSAPELFTSL----- 480

  Fly   147 HVPVFANN--------LSSALFVITISGGLIFYISPFKMNSYETV--------RDILFLLL-ATL 194
             :.||.::        :.||:|      .::|.|....:.|.|.:        ||:.|.:| .::
Mouse   481 -IGVFISHSNVGIGTIVGSAVF------NILFVIGTCALFSREILNLTWWPLFRDVSFYILDLSM 538

  Fly   195 LMDYFAYTTNHFALGYEFKFFIVLLVYISYIII----NVADVYLLQKTIASTRTKMQKLLDEKQT 255
            |:.:|   .:.|...:|  ..::||.|..|:..    ...::::.::.......|:..|.|..:.
Mouse   539 LIVFF---LDSFIAWWE--SLLLLLAYALYVFTMKWNKQIELWVKEQLSRRPVAKVMALGDLSKP 598

  Fly   256 PEIALKLQDLE--RKLEYYSQDTRVEILEKSSSISITRIRYTTMRMI 300
            .|.|::..:.:  :||:..|..||.   ..|:|:..:.||.|...::
Mouse   599 SEDAVEENEQQDSKKLKLPSVLTRG---SSSASLHNSIIRNTIYHLM 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5348NP_611156.3 Na_Ca_ex 86..>186 CDD:279963 26/115 (23%)
Na_Ca_ex 458..603 CDD:279963
Slc24a1NP_659062.1 2A1904 1..1130 CDD:273344 53/242 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.