DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-104 and ARK3

DIOPT Version :10

Sequence 1:NP_611155.3 Gene:unc-104 / 36876 FlyBaseID:FBgn0267002 Length:1739 Species:Drosophila melanogaster
Sequence 2:NP_001184972.1 Gene:ARK3 / 837799 AraportID:AT1G12430 Length:920 Species:Arabidopsis thaliana


Alignment Length:166 Identity:34/166 - (20%)
Similarity:53/166 - (31%) Gaps:70/166 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GIGPEI-SAAVQKIFAVANVPIEWETVDVTPVRNPDGKFGIPQGAIDSVNRNKVGLKGPLMTPVG 159
            |:.|.: ..|:...||:..|...|              |..|   .|.|||::            
plant    18 GLSPVVFFTALALAFAIYQVISGW--------------FASP---FDDVNRHQ------------ 53

  Fly   160 KGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDNVDVVTIRENTEGEYSG----------IEHE 214
               |:.:||..:|                ..:...|.|..|.|....:|.|          |:|:
plant    54 ---RARSLAQEEE----------------PPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQ 99

  Fly   215 IVDGVVQS----------IKLITEEASNRVAEYAFK 240
            |.| |.||          .....::||..:|:.:|:
plant   100 IYD-VTQSRMFYGPGGPYALFAGKDASRALAKMSFE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-104NP_611155.3 KISc_KIF1A_KIF1B 2..358 CDD:276816 34/166 (20%)
Kinesin_assoc 355..498 CDD:465047
FHA_KIF1 474..574 CDD:438757
YhaN <575..>666 CDD:443752
KIF1B 878..924 CDD:463574
DUF3694 1199..1347 CDD:463599
PH_KIFIA_KIFIB 1602..1704 CDD:269939
ARK3NP_001184972.1 Kinesin 76..412 CDD:459720 14/60 (23%)
EnvC 425..>620 CDD:443969
armadillo repeat 656..687 CDD:293788
Arm 693..731 CDD:425727
armadillo repeat 696..729 CDD:293788
Syo1_like 697..>883 CDD:474028
armadillo repeat 736..773 CDD:293788
armadillo repeat 779..811 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.