DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5267 and CG34189

DIOPT Version :9

Sequence 1:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001097347.1 Gene:CG34189 / 5740826 FlyBaseID:FBgn0085218 Length:122 Species:Drosophila melanogaster


Alignment Length:97 Identity:42/97 - (43%)
Similarity:52/97 - (53%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IGEEIALKRNPLPEE---KYIKQPFKFGCCHNSTYVGCAGVCPETCEYRSKYCVPLCGPPCRCKR 168
            |.|:..|..:..|:.   |||..||...|..|:|.|.|||||||||.::|..|...||..|.||.
  Fly    25 IDEDHILNHDVDPDPGRMKYIWNPFSGFCGENATMVRCAGVCPETCAFKSLKCPKYCGVNCVCKP 89

  Fly   169 GYVYNIPHSACTLRSDCPKGIVQSKNGIYRVF 200
            .||:|.....|.|::|||..|.|.....:|||
  Fly    90 DYVFNENLQLCILKTDCPLDIKQLVVETHRVF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5267NP_611154.2 TIL 132..185 CDD:334697 25/52 (48%)
CG34189NP_001097347.1 TIL 53..106 CDD:280072 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138202at33392
OrthoFinder 1 1.000 - - FOG0014389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.