DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5267 and Acp62F

DIOPT Version :10

Sequence 1:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster


Alignment Length:67 Identity:34/67 - (50%)
Similarity:39/67 - (58%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KFGCCHNSTYVGCAGVCPETCEYRSK-YCVPLCGPPCRCKRGYVYNIPHSACTLRSDCPKGIVQS 192
            |..|..|.|...|...|||||||... .||.:||.||.||.|||.|....||.|||||||.:|:.
  Fly    31 KVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRK 95

  Fly   193 KN 194
            ::
  Fly    96 ED 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5267NP_611154.2 TIL 132..185 CDD:460351 28/53 (53%)
Acp62FNP_523892.1 TIL 34..88 CDD:460351 28/53 (53%)

Return to query results.
Submit another query.