DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5267 and F36H9.4

DIOPT Version :9

Sequence 1:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_872222.2 Gene:F36H9.4 / 353436 WormBaseID:WBGene00018112 Length:78 Species:Caenorhabditis elegans


Alignment Length:55 Identity:15/55 - (27%)
Similarity:21/55 - (38%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CCHNSTYVGCAGVCPETC-EYRSKYCVPLC-GPPCRCKRGYVYN-----IPHSAC 179
            |..|..:..|...|...| |....:|...| ...|:||.|:..|     :|.:.|
 Worm    24 CGPNEDFKECGTACEANCAEGHVMFCTMQCIVNVCQCKDGFFRNKDKKCVPRNKC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5267NP_611154.2 TIL 132..185 CDD:334697 15/55 (27%)
F36H9.4NP_872222.2 TIL 24..78 CDD:366828 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.