DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5267 and C25E10.10

DIOPT Version :10

Sequence 1:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_505347.1 Gene:C25E10.10 / 182894 WormBaseID:WBGene00016099 Length:169 Species:Caenorhabditis elegans


Alignment Length:72 Identity:19/72 - (26%)
Similarity:31/72 - (43%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PLPEEKYIKQPFKFGCCHNSTYVGCAGVCPETCEYRSKYCVPLC-GPPCRCKRGYVYNIPHSACT 180
            |:|    |::|   .|..:.....|...|..||:..:..|..:| ...|:||:|.|.:.....|.
 Worm    69 PIP----IRKP---ECEGDEELKACGSACEPTCDNENPECDLVCMTNVCQCKKGLVRDSATGKCV 126

  Fly   181 LRSDCPK 187
            .::.|.|
 Worm   127 EKNKCSK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5267NP_611154.2 TIL 132..185 CDD:460351 13/53 (25%)
C25E10.10NP_505347.1 TIL 77..131 CDD:410995 13/53 (25%)

Return to query results.
Submit another query.