powered by:
Protein Alignment CG5267 and C25E10.10
DIOPT Version :9
Sequence 1: | NP_611154.2 |
Gene: | CG5267 / 36875 |
FlyBaseID: | FBgn0034154 |
Length: | 201 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505347.1 |
Gene: | C25E10.10 / 182894 |
WormBaseID: | WBGene00016099 |
Length: | 169 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 31/72 - (43%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 PLPEEKYIKQPFKFGCCHNSTYVGCAGVCPETCEYRSKYCVPLC-GPPCRCKRGYVYNIPHSACT 180
|:| |::| .|..:.....|...|..||:..:..|..:| ...|:||:|.|.:.....|.
Worm 69 PIP----IRKP---ECEGDEELKACGSACEPTCDNENPECDLVCMTNVCQCKKGLVRDSATGKCV 126
Fly 181 LRSDCPK 187
.::.|.|
Worm 127 EKNKCSK 133
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5267 | NP_611154.2 |
TIL |
132..185 |
CDD:334697 |
13/53 (25%) |
C25E10.10 | NP_505347.1 |
TIL |
77..131 |
CDD:366828 |
13/53 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.