powered by:
Protein Alignment CG5267 and C25E10.8
DIOPT Version :9
Sequence 1: | NP_611154.2 |
Gene: | CG5267 / 36875 |
FlyBaseID: | FBgn0034154 |
Length: | 201 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370492.1 |
Gene: | C25E10.8 / 182892 |
WormBaseID: | WBGene00016097 |
Length: | 137 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 20/58 - (34%) |
Similarity: | 25/58 - (43%) |
Gaps: | 4/58 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 CCHNSTYVGCAGVCPETCEYRS-KYCVPLC-GPPCRCKRGYVYNIPHSACTLRSDCPK 187
|..|.|:..|...|..|||... :.|...| ...|:|..|:|.| ...||...:|||
Worm 82 CPENETFFRCGTACEPTCEKPGPRPCTRQCIVNVCQCSSGFVRN--GYRCTELKECPK 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5267 | NP_611154.2 |
TIL |
132..185 |
CDD:334697 |
17/54 (31%) |
C25E10.8 | NP_001370492.1 |
TIL |
21..75 |
CDD:418800 |
|
TIL |
82..135 |
CDD:410995 |
17/54 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.