DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5267 and spi-3

DIOPT Version :10

Sequence 1:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_505344.2 Gene:spi-3 / 182891 WormBaseID:WBGene00016096 Length:157 Species:Caenorhabditis elegans


Alignment Length:60 Identity:21/60 - (35%)
Similarity:24/60 - (40%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PFKFGCCHNSTYVGCAGVCPETCEYRSKYCVPLCGP-PCRCKRGYVYNIPHSACTLRSDC 185
            ||...|..|...|.|...|...|.:....|...|.| .|.||.|||.|..:. |..|.:|
 Worm    25 PFLPECGKNQKRVACGYDCEPQCGFDPTVCSLECKPNACVCKDGYVRNTKND-CVRRLEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5267NP_611154.2 TIL 132..185 CDD:460351 18/53 (34%)
spi-3NP_505344.2 TIL 30..83 CDD:460351 18/53 (34%)
TIL 90..144 CDD:460351
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.