powered by:
Protein Alignment CG5267 and Y69H2.3
DIOPT Version :9
Sequence 1: | NP_611154.2 |
Gene: | CG5267 / 36875 |
FlyBaseID: | FBgn0034154 |
Length: | 201 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001360619.1 |
Gene: | Y69H2.3 / 180221 |
WormBaseID: | WBGene00013481 |
Length: | 826 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 23/70 - (32%) |
Similarity: | 27/70 - (38%) |
Gaps: | 6/70 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 CCHNSTYVGCAGVCPE-TCEYRSK--YCVPLCGPPCRCKRGYVYNIPHSACTLRSDCPKGIVQSK 193
|..|.|...|...|.| .|...|| .|...||..|.|..||:.: ....|....|||....|::
Worm 588 CAKNQTMSDCLNTCSEDKCPGMSKSMMCTKHCGQGCACASGYLRS-SDGECYKPKDCPPECGQNE 651
Fly 194 NGIYR 198
. ||
Worm 652 E--YR 654
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.