DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5267 and CG42878

DIOPT Version :10

Sequence 1:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001356904.1 Gene:CG42878 / 12798348 FlyBaseID:FBgn0262170 Length:90 Species:Drosophila melanogaster


Alignment Length:66 Identity:23/66 - (34%)
Similarity:32/66 - (48%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CCHNSTYVGCAGVCPETCE---YRSKYCVP-LCGPPCRCKRGYVYNIPHS--ACTLRSDCPKGIV 190
            |.|....|.|..|||:.|.   ||.| ||| .|...|.|.:|:: .:.|:  .|..|..|.:.|:
  Fly    27 CTHGDLMVKCIPVCPKICADFLYRQK-CVPKKCERGCACPKGWL-RLKHNQGRCITRKQCKRYII 89

  Fly   191 Q 191
            :
  Fly    90 E 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5267NP_611154.2 TIL 132..185 CDD:460351 21/58 (36%)
CG42878NP_001356904.1 TIL 27..84 CDD:460351 21/58 (36%)

Return to query results.
Submit another query.