DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp53C14b and Acp53C14c

DIOPT Version :9

Sequence 1:NP_001286502.1 Gene:Acp53C14b / 36873 FlyBaseID:FBgn0034153 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001014532.1 Gene:Acp53C14c / 3346203 FlyBaseID:FBgn0053530 Length:124 Species:Drosophila melanogaster


Alignment Length:124 Identity:28/124 - (22%)
Similarity:61/124 - (49%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KSIFLLS---ILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLADKIVPTVYELKQCSGY 66
            |.:|.::   :|...|:|.|.|   ::.....:|.:||:..::..|:|..:.:|.|.:|.:|:.:
  Fly     4 KQVFYIAFSLLLLGSLLPNEVE---SLRVDLNKLAECTESGLKVATTLLVRAIPCVKKLAKCADF 65

  Fly    67 VTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKCLHGLLNKLAATIKPFAEQISGLGCL 125
            ..::.   ||..||....:.|::.:.:| :..:||...|.:....:.|..:::....||
  Fly    66 RAIKT---KDLDITALALLGYQYLQTVV-NNQRCLLISLKEGYDAVSPHLDKLISGKCL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp53C14bNP_001286502.1 ACP53EA 33..125 CDD:283876 19/91 (21%)
Acp53C14cNP_001014532.1 ACP53EA 32..120 CDD:283876 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.