DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp53C14a and Acp53Ea

DIOPT Version :9

Sequence 1:NP_001286501.1 Gene:Acp53C14a / 36872 FlyBaseID:FBgn0034152 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_477151.1 Gene:Acp53Ea / 36874 FlyBaseID:FBgn0015584 Length:120 Species:Drosophila melanogaster


Alignment Length:121 Identity:34/121 - (28%)
Similarity:64/121 - (52%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENSITAISLLSDCVDFQP 65
            |.|||:.|:.|.|||...:|.:|. :...:::|.|..:.|.|.|.::..:|..:..|.:|:||.|
  Fly     1 MKLIKVTLVFSLLALVFVAQTEAQ-NPIWENWLACNRIGTKALASLLRETIPTVRNLLNCIDFNP 64

  Fly    66 KIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFTTGVGLIRPIIAKFDSLRCFDE 121
            ...:..|.|..:::.::..|:...|:.:||:......|.|:||.:...::.:|..|
  Fly    65 PTDIGNSYLSKLKLYYELVKRGALDKTQCLIVPLKESVRLLRPYVKSLETNKCLGE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp53C14aNP_001286501.1 ACP53EA 30..119 CDD:283876 21/88 (24%)
Acp53EaNP_477151.1 ACP53EA 29..118 CDD:283876 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016584
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.