DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and MPDZ

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_001362342.1	Gene:	MPDZ / 8777	HGNCID:	7208	Length:	2103	Species:	Homo sapiens

Alignment Length:	84	Identity:	26/84 - (30%)
Similarity:	46/84 - (54%)	Gaps:	3/84 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 GMEVTGGIDQFEPLTIVN-VSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYV 106
            |:.:.||.|......|:: |...|.| |.|.:..||:|.::|.:...:.|.:||:.:.|:..:.|
Human  1673 GLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRV 1737

  Fly   107 RVYVRGDDDAPGEEDWTCD 125
            |:.:. .|:||.:|:..||
Human  1738 RLTLY-RDEAPYKEEEVCD 1755

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	20/68 (29%)
MPDZ	NP_001362342.1	PDZ_signaling	2019..2102	CDD:238492
		L27_2	6..63	CDD:312549
		PDZ_signaling	139..221	CDD:238492
		PDZ_signaling	257..334	CDD:238492
		PDZ	374..463	CDD:214570
		PDZ_signaling	560..629	CDD:238492
		PDZ_signaling	698..784	CDD:238492
		PDZ_signaling	1006..1076	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1121..1140
		PDZ_signaling	1149..1240	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1278..1324
		PDZ	1347..1433	CDD:214570
		PDZ_signaling	1514..1593	CDD:238492
		MPDZ_u10	1595..1659	CDD:374710
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1600..1645
		PDZ	1660..1744	CDD:214570	20/71 (28%)
		PDZ_signaling	1758..1836	CDD:238492
		PDZ_signaling	1893..1978	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810