DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and Pard3

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_112514.1	Gene:	Pard3 / 81918	RGDID:	620374	Length:	1337	Species:	Rattus norvegicus

Alignment Length:	80	Identity:	19/80 - (23%)
Similarity:	35/80 - (43%)	Gaps:	14/80 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    56 PLTIVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFR--KNSRYVRVYVRGDDDAP 117
            |:.:.|:.|.|.| :.|.::.||.:.::|.|.....:..|.:.:.|  |....|.:.|...::|
  Rat   487 PIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEA- 550

  Fly   118 GEEDWTCDCWFKPRK 132
                      |.||:
  Rat   551 ----------FHPRE 555

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	14/57 (25%)
Pard3	NP_112514.1	DUF3534	1..146	CDD:288873
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	81..109
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	143..263
		PDZ_signaling	272..347	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	397..441
		PDZ_signaling	465..544	CDD:238492	14/56 (25%)
		PDZ_signaling	588..681	CDD:238492
		Interaction with PRKCI and PRKCZ. /evidence=ECO:0000269\|PubMed:9763423	712..936
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	866..888
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	932..1015
		Interaction with FRMD4A. /evidence=ECO:0000250\|UniProtKB:Q99NH2	935..1337
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1028..1055
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1110..1271
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1284..1337
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900