DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Grip1

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006514294.1 Gene:Grip1 / 74053 MGIID:1921303 Length:1185 Species:Mus musculus


Alignment Length:245 Identity:55/245 - (22%)
Similarity:92/245 - (37%) Gaps:76/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
            |:::.| |.|..|.......:.||:|     :..|....|:.::|..:.|:|:.|.:::..|||:
Mouse   707 KLKIRK-DEDNSDEQESSGAIIYTVE-----LKRYGGPLGITISGTEEPFDPIIISSLTKGGLAE 765

  Fly    70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAPGEEDWTCDCWFKPRK- 132
            | |.:.:||.|..||.........:||:.:.:.....|.:.::...||....        .|:| 
Mouse   766 RTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSAS--------SPKKF 822

  Fly   133 ----------PWRRDFTPIQWTFPWNDRRKPVYKESNCF--MVPSKMEEKIRARRAATSAV---- 181
                      ....|.:|||         || .|.|:.:  .|||           ..|||    
Mouse   823 PIPGHSGDLGDGEEDPSPIQ---------KP-GKLSDAYPSTVPS-----------VDSAVDSWD 866

  Fly   182 ----------------------HKKDELAPHTR-SLTPTPRPKNQPGPNL 208
                                  :..|..:|..| ||:|.|:|::|..|::
Mouse   867 GSGIDASYGSQGSTFQTSGYNYNTYDWRSPKQRTSLSPVPKPRSQTYPDV 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/81 (25%)
Grip1XP_006514294.1 PDZ_signaling 110..190 CDD:238492
PDZ_signaling 209..292 CDD:238492
PDZ_signaling 307..390 CDD:238492
PDZ_signaling 526..614 CDD:238492
PDZ_signaling 627..711 CDD:238492 1/3 (33%)
PDZ_signaling 727..808 CDD:238492 22/85 (26%)
PDZ_signaling 1058..1138 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.