DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15617 and Whrn

DIOPT Version :9

Sequence 1:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_001008791.1	Gene:	Whrn / 73750	MGIID:	2682003	Length:	918	Species:	Mus musculus

Alignment Length:	144	Identity:	34/144 - (23%)
Similarity:	59/144 - (40%)	Gaps:	34/144 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MFDSKIR----------VPKYDSDAFDNVAYELQMTYTLET-----------------DCRIMSF 38
            :.||.::          :|:.|...||.  |..:..|...|                 :.|::|.
Mouse    82 LLDSPVKRRLLPMLRLVIPRSDQLLFDQ--YTAEGLYLPATTPYRQPAWAAPDGAGPGEVRLVSL 144

  Fly    39 YDAM----WGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMF 99
            ..|.    .|..:.||.:....:.:..|.|..||::.|:||||:|.::||.....:|..||::..
Mouse   145 RRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKAL 209

  Fly   100 RKNSRYV-RVYVRG 112
            :.:.:.| .||..|
Mouse   210 KGSKKLVLSVYSAG 223

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	25/102 (25%)
Whrn	NP_001008791.1	HN_L-whirlin_R1_like	38..113	CDD:259822	7/32 (22%)
		PDZ_signaling	139..216	CDD:238492	21/76 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	240..266
		PDZ_signaling	278..358	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..407
		HN_L-whirlin_R2_like	420..500	CDD:259823
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	503..538
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	560..824
		PDZ_signaling	827..898	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900