DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Pdzd11

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001343313.1 Gene:Pdzd11 / 72621 MGIID:1919871 Length:140 Species:Mus musculus


Alignment Length:124 Identity:29/124 - (23%)
Similarity:52/124 - (41%) Gaps:21/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVPKYDS------DAFDNVA-------------YELQMTYTLETDCRIMSFYDAMWGMEVTGGID 52
            |:| ||.      .|::|..             |..::|..|.....:.....|..|..:.||..
Mouse     4 RIP-YDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKA 67

  Fly    53 QFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVR 111
            ....:.|..|.|...|.|.|::.||::..:|||...::..::|:::. |.:|.:.:.||
Mouse    68 SQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEIL-KTAREISMRVR 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 18/80 (23%)
Pdzd11NP_001343313.1 PDZ_signaling 45..125 CDD:238492 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.