DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Ush1c

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_710143.2 Gene:Ush1c / 72088 MGIID:1919338 Length:910 Species:Mus musculus


Alignment Length:108 Identity:27/108 - (25%)
Similarity:46/108 - (42%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FDNVAYELQMTYTLETD------------CRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLA 68
            ||.:...:.:.:.:|.|            .|:...:....|:.|.||::....|.|.::...|.|
Mouse    59 FDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKGGQA 123

  Fly    69 KRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVR 111
            ...|::|||||.:||.......|..|.:.:.| ..:.|.:.||
Mouse   124 DSVGLQVGDEIVRINGYSISSCTHEEVINLIR-TKKTVSIKVR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 23/92 (25%)
Ush1cNP_710143.2 N-terminal domain. /evidence=ECO:0000250|UniProtKB:Q9Y6N9 1..86 4/26 (15%)
harmonin_N 2..80 CDD:259819 4/20 (20%)
PDZ_signaling 85..165 CDD:238492 21/80 (26%)
Mediates interaction with MYO7B. /evidence=ECO:0000250|UniProtKB:Q9Y6N9 194..833
PDZ_signaling 209..289 CDD:238492
Cgr1 <309..>358 CDD:281823
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..688
PDZ_signaling 751..838 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 890..910
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.