DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Pdzk1

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:102 Identity:20/102 - (19%)
Similarity:45/102 - (44%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKN-SRYVRVYVRGDDDAPGEEDW 122
            :.:::|.|:|.:.|:...|.:.::|.......:..|.::...|: ||.:.:.|         :..
  Rat   160 LTDITPQGVAMKAGVLADDHLIEVNGENVENASHEEVVEKVTKSGSRIMFLLV---------DKE 215

  Fly   123 TCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKESN 159
            |..|..:.:.|::|:...:: ..|...|...:.|.||
  Rat   216 TARCHSEQKTPFKRETASLK-LLPHQPRVVVIKKGSN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 10/52 (19%)
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492
PDZ 132..212 CDD:214570 10/51 (20%)
PDZ_signaling 242..320 CDD:238492 4/10 (40%)
PDZ 375..455 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.