DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Pdzd2

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038959013.1 Gene:Pdzd2 / 65034 RGDID:619958 Length:2818 Species:Rattus norvegicus


Alignment Length:280 Identity:54/280 - (19%)
Similarity:101/280 - (36%) Gaps:86/280 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DSKI--RVPKYD---SDAFDNVAY-ELQMTYTLETDCRIMSFYDAMW-----------GMEVTGG 50
            ||::  ||||.:   ||:.|...: :...|....:||........:|           |::|:||
  Rat   287 DSEVELRVPKTEAPLSDSNDKRRFSKTGKTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSGG 351

  Fly    51 I-DQFEP--LTIVNVSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVR 111
            . .:..|  :.:..|...|.|.|.| :.:|||:..||....:.::..||:.:.|..:..|::.|.
  Rat   352 RGSKRSPHAIVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVAILRSATGMVQLVVA 416

  Fly   112 G---------------------------------DDDAPGEEDWTCDCWFKPRKPWRRDFTPIQW 143
            .                                 |.:|.||::       :...|     ..::.
  Rat   417 SKESSAEDLLKLTSKSLPDLTSSVEDMSSWTDNEDQEAAGEDE-------EGSGP-----AAVRV 469

  Fly   144 TFPWNDRRKPV------------YKESNCFMVPSKMEEKIRARRAATSAVHKKDELA-----PHT 191
            |.|.::..:.|            .|:.||   .:|::.::........:|.:.:||.     |..
  Rat   470 TMPGSEESQDVGSSEESKGNLESPKQGNC---KTKLKSRLSGGVHRLESVEEYNELMVRNGDPRI 531

  Fly   192 RSLTPTPRPKNQPGPNLLET 211
            |.|..:...:....|.||::
  Rat   532 RMLEVSRDGRKHSLPQLLDS 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 22/95 (23%)
Pdzd2XP_038959013.1 PDZ_signaling 335..416 CDD:238492 19/80 (24%)
PDZ_signaling 590..671 CDD:238492
PDZ_signaling 729..813 CDD:238492
PHA03247 <985..1446 CDD:223021
PDZ_signaling 2603..2677 CDD:238492
PDZ_signaling 2731..2813 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.