powered by:
Protein Alignment CG15617 and Slc9a3r1
DIOPT Version :9
Sequence 1: | NP_611151.1 |
Gene: | CG15617 / 36871 |
FlyBaseID: | FBgn0034151 |
Length: | 222 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_067605.1 |
Gene: | Slc9a3r1 / 59114 |
RGDID: | 708538 |
Length: | 356 |
Species: | Rattus norvegicus |
Alignment Length: | 62 |
Identity: | 16/62 - (25%) |
Similarity: | 27/62 - (43%) |
Gaps: | 4/62 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 GGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYV 110
|.:.||..| |.|...|::.|:..||.:.::|.....:.|..:.:...|.....||:.|
Rat 33 GKVGQFIRL----VEPGSPAEKSGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLV 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.